Usage Example doesn't work
Nobody has claimed this yet.
Assessment
- Difficulty
- 3/5
- Estimated time
- 1-2 days
- Newbie friendliness
- 35/100
- Issue type
- Bug
- Clarity
- Mostly clear
- Activity status
- Stale
- Tech stack
- rust
- Domain
- cli, cryptography
Research direction
Start by running the documented seedtool --in sskr command with the two shares shown in the issue and inspect the CLI's SSKR input handling. Compare the usage example with the observed behavior; done means a 2-of-3 recovery completes after two shares without requiring Ctrl+C.
Written by the indexing model from the issue text.
Description
I'm trying the usage examples, but I can't recover seeds with SSKR, every time I press enter it asks for another input, I have to end it with Ctrl+C like here:
C:\Users\aaa\.cargo\bin>seedtool` --out sskr -g 2-of-3 -s btwm
tantkpgowkguaeadaersrncktdjyoysalgpfuturndjyuecamhwswtwdos
tantkpgowkguaeadadsfvadtptvdrevwylwlgamnptsffguebznypriast
tantkpgowkguaeadaohkbajodkgaldlkkkaowykizmctyklalysfbglahh
C:\Users\aaa\.cargo\bin>seedtool --in sskr
tantkpgowkguaeadaersrncktdjyoysalgpfuturndjyuecamhwswtwdos
tantkpgowkguaeadadsfvadtptvdrevwylwlgamnptsffguebznypriast
^D
^C
C:\Users\aaa\.cargo\bin>
- Dominant language
- Rust
- Stars
- 11
- Forks
- 0
- PR merge metrics
- No merged PRs in 30d
Contributor guide
First steps
- Read the whole issue, then the project's contributing guide.
- Comment on the issue to say you are picking it up — it saves two people doing the same work.
- Fork the repository and make your change on a branch.
- Open a pull request that references the issue number.
More from BlockchainCommons/seedtool-cli-rust
-
Difficulty 3/5 1-2 days Newbie friendliness 35/100
BlockchainCommons/seedtool-cli-rust#10 · 2 comments ·
-
enhancement
Difficulty 5/5 Over a week Newbie friendliness 25/100
BlockchainCommons/seedtool-cli-rust#9 · 1 comment ·
All issues in BlockchainCommons/seedtool-cli-rust
Similar issues
-
Difficulty 2/5 1-3 hours Newbie friendliness 85/100
-
Difficulty 2/5 1-3 hours Newbie friendliness 84/100
Eynzof/Hermes-CN-Desktop#610 ·
-
Difficulty 2/5 1-3 hours Newbie friendliness 88/100
-
bug team:backend track:services-maintenance
Difficulty 2/5 1-3 hours Newbie friendliness 78/100
cowprotocol/services#4950 ·
-
bug
Difficulty 2/5 1-3 hours Newbie friendliness 68/100
gitbutlerapp/gitbutler#15998 · 1 comment ·